Recombinant Mouse C-C Motif Chemokine 21a is produced by our E.coli expression system and the target gene encoding Ser24-Gly133 is expressed.

CCL21a蛋白, 蛋白, 6Ckine蛋白;C-C Motif Chemokine 21a, 6Ckine, Beta-Chemokine Exodus-2, Small-Inducible Cytokine A21a, Thymus-Derived Chemotactic Agent 4, TCA4, Ccl21a, Scya21, Scya21a

Escherichia coli.

Lyophilized from a 0.2 μm filtered solution of 20mM PB，150mM NaCl,pH7.4.

SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMR RLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

C-C Motif Chemokine 21a (CCL21a) is a small secreted cytokine that belongs to the intercrine beta (CC chemokine) family. Mouse CCL21 cDNA encodes a 133 amino acid residue protein with a 23 residue signal peptide that is cleaved to generate the 110 residue mature protein. Mouse CCL21 has three forms while CCL21a has Ser-65. CCL21 elicits its effects by binding to a cell surface chemokine receptor known as CCR7 and CXCR3. Mouse CCL21 inhibits hemopoiesis and stimulates chemotaxis. It has chemotactic function in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Mouse CCL21 shows preferential activity towards naive T-cells and may play a role in mediating homing of lymphocytes to secondary lymphoid organs.

P84444